PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 474aa    MW: 53115.6 Da    PI: 5.5921
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023527.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.49e-92594702373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl..fsevsPilkfshl 96 
                  ++lL++cA+a++++d++laq++L+ l+++a +dgd++qRl+  f++AL ar ar    ++ +a++ s+++ + +++++++++l  f +++P+++f++ 
  Pbr023527.1  59 EQLLVHCANAIETNDATLAQQILWVLNNIAPQDGDSNQRLTCAFLRALIARAARiGNCKVLAAMANSQANFTIHTHKFSVVELasFIDLTPWHRFGFT 156
                  79****************************************************4445677777777777666888888888789************* PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl....... 181
                  taN aIleaveg + vHi+D+++++++Q p+L +a+a R     +pp l++T+ g +e +      ++ee+g++L +fA++ ++ +ef+v+       
  Pbr023527.1 157 TANAAILEAVEGYSVVHIVDLSLTHCMQIPTLVDAIARRHdgnVSPPLLKLTVAGTMEDVppmLDLSYEELGSKLVNFARSRNIILEFRVIpssytdg 254
                  ***************************************9655569**********998898888999***********************8885555 PP

         GRAS 182 vakrledleleeLrvkp.gEalaVnlvlqlhrll.........................desvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                   a+ +++l++++L   +  Eal+Vn++++lh++                          ++s s++s r+ +Lk +++l+P++vv+v++++d++s++ 
  Pbr023527.1 255 FANLIQQLRVQNLVYAEsSEALVVNCHMMLHYISeealtlpainpnpsssgstssygfdASSSSSSSLRTVFLKELRGLEPTIVVLVDEDVDLTSNNP 352
                  555555556666655559****************************************8888888889****************************** PP

         GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                  + r+ +a++y +  +d+l++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +r+++a F++v+++e+a+ ++k++l +++  g+ +
  Pbr023527.1 353 VCRLRSAFNYLWIPYDTLDTFLPRGSKQRQWYEAD-VCWKIENVIAYEGFQRVERLEPKCRWVQRMRNANFRSVSFGEDAVLEVKAMLDEHA-TGWGL 448
                  ***********************************.99******************************************************.9999* PP

         GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
                  + e++ +vl+Wk++++v+++aW
  Pbr023527.1 449 KREEEDVVLTWKGHNVVFATAW 470
                  ********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.93332452IPR005202Transcription factor GRAS
PfamPF035143.1E-8959470IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MMQFTETPPP PLHEIITTPY SNNFPIMMNT NQTYRTRPWP GFPTSKFLGT NFGDANCMEQ  60
LLVHCANAIE TNDATLAQQI LWVLNNIAPQ DGDSNQRLTC AFLRALIARA ARIGNCKVLA  120
AMANSQANFT IHTHKFSVVE LASFIDLTPW HRFGFTTANA AILEAVEGYS VVHIVDLSLT  180
HCMQIPTLVD AIARRHDGNV SPPLLKLTVA GTMEDVPPML DLSYEELGSK LVNFARSRNI  240
ILEFRVIPSS YTDGFANLIQ QLRVQNLVYA ESSEALVVNC HMMLHYISEE ALTLPAINPN  300
PSSSGSTSSY GFDASSSSSS SLRTVFLKEL RGLEPTIVVL VDEDVDLTSN NPVCRLRSAF  360
NYLWIPYDTL DTFLPRGSKQ RQWYEADVCW KIENVIAYEG FQRVERLEPK CRWVQRMRNA  420
NFRSVSFGED AVLEVKAMLD EHATGWGLKR EEEDVVLTWK GHNVVFATAW MPA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0060859e-32AP006085.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT28L24, TM0128, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379313.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-179SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM5VYZ60.0M5VYZ6_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-174GRAS family protein